PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KN539958.1_FGP002
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MIKC_MADS
Protein Properties Length: 279aa    MW: 31604.2 Da    PI: 9.6736
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KN539958.1_FGP002genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF93.41.1e-29959151
                       S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
             SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                       krien + rqvtfskRrng+lKKA+ELSvLCdaeva+i+fs++g+lye++s
  KN539958.1_FGP002  9 KRIENPTSRQVTFSKRRNGLLKKAFELSVLCDAEVALIVFSPRGRLYEFAS 59
                       79***********************************************86 PP

2K-box60.66.3e-21127218798
              K-box   7 ksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                        k  ++  +++ + +   L k++e L ++ R++lGe+Le +s++eL+ Le +Leksl +iR kK+ell +qi +l++ke+ l ++n++Lr k 
  KN539958.1_FGP002 127 KTIQQDIQKQVKDDTLGLAKKLEALDESRRKILGENLEGCSIEELRGLEMKLEKSLHNIRLKKTELLEQQIAKLKEKERTLLKDNENLRGKH 218
                        33566667888999999***********************************************************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.1E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.314161IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
SuperFamilySSF554557.33E-28365IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-30323IPR002100Transcription factor, MADS-box
CDDcd002655.31E-36364No hitNo description
PfamPF003196.2E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-303859IPR002100Transcription factor, MADS-box
PfamPF014861.0E-21128217IPR002487Transcription factor, K-box
PROSITE profilePS5129713.463134224IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010048Biological Processvernalization response
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MVRGRTELKR IENPTSRQVT FSKRRNGLLK KAFELSVLCD AEVALIVFSP RGRLYEFASA  60
PSTRIVYLAP SSLASTPAGE WREWREDLAR KYLSLQAMIC NELNFLLTLQ KTIDRYKAYT  120
KDHVNNKTIQ QDIQKQVKDD TLGLAKKLEA LDESRRKILG ENLEGCSIEE LRGLEMKLEK  180
SLHNIRLKKT ELLEQQIAKL KEKERTLLKD NENLRGKHRN LEAAALVANH MTTTATAAWP  240
RDMPTTSSSA AAADAMDVET ELYIGLPGTE RSSNRSETG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P9e-17166166Myocyte-specific enhancer factor 2B
1tqe_Q9e-17166166Myocyte-specific enhancer factor 2B
1tqe_R9e-17166166Myocyte-specific enhancer factor 2B
1tqe_S9e-17166166Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF1419650.0AF141965.1 Oryza sativa MADS-box protein FDRMADS8 mRNA, complete cds.
GenBankAK0701350.0AK070135.1 Oryza sativa Japonica Group cDNA clone:J023043P08, full insert sequence.
GenBankAY5519190.0AY551919.1 Oryza sativa (japonica cultivar-group) MADS-box protein RMADS214 mRNA, complete cds.
GenBankCT8325590.0CT832559.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSN008N04, full insert sequence.
GenBankEU5192290.0EU519229.1 Oryza sativa Indica Group cultivar MR84 MADS-box protein UMS1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015614799.11e-150PREDICTED: MADS-box transcription factor 56
SwissprotA2Z9Q71e-154MAD56_ORYSI; MADS-box transcription factor 56
TrEMBLA0A0E0IVI51e-152A0A0E0IVI5_ORYNI; Uncharacterized protein
TrEMBLA0A0E0IVI61e-152A0A0E0IVI6_ORYNI; Uncharacterized protein
TrEMBLB1Q0C61e-152B1Q0C6_ORYSI; MADS-box protein UMS1
STRINGBGIOSGA033356-PA1e-152(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14133379
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.13e-56AGAMOUS-like 20